Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50206583 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_428724 (CHEMBL915240) |
---|
Ki | 3088±n/a nM |
---|
Citation | Prezzavento, O; Campisi, A; Ronsisvalle, S; Li Volti, G; Marrazzo, A; Bramanti, V; Cannavò, G; Vanella, L; Cagnotto, A; Mennini, T; Ientile, R; Ronsisvalle, G Novel sigma receptor ligands: synthesis and biological profile. J Med Chem50:951-61 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50206583 |
---|
n/a |
---|
Name | BDBM50206583 |
Synonyms: | CHEMBL373686 | methyl (1R,2S/1S,2R)-1-phenyl-2-[(4-pyrimidin-2-ylpiperazin-1-yl)methyl]cyclopropanecarboxylate |
Type | Small organic molecule |
Emp. Form. | C20H24N4O2 |
Mol. Mass. | 352.4302 |
SMILES | COC(=O)C1(CC1CN1CCN(CC1)c1ncccn1)c1ccccc1 |
Structure |
|