| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50292293 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_434272 (CHEMBL918432) |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Vazquez, J; Tautz, L; Ryan, JJ; Vuori, K; Mustelin, T; Pellecchia, M Development of molecular probes for second-site screening and design of protein tyrosine phosphatase inhibitors. J Med Chem50:2137-43 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50292293 |
|---|
| n/a |
|---|
| Name | BDBM50292293 |
|---|
| Synonyms: | 4-(5-((4-hydroxy-3-(methoxycarbonyl)phenyl)amino)-5-oxopentanamido)-2,2,6,6-tetramethylpiperidin-1-olate | CHEMBL265864 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H32N3O6 |
|---|
| Mol. Mass. | 434.506 |
|---|
| SMILES | COC(=O)c1cc(NC(=O)CCCC(=O)NC2CC(C)(C)N([O])C(C)(C)C2)ccc1O |^1:22| |
|---|
| Structure | 
|
|---|
Search and Browse
