| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM50292295 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_434268 (CHEMBL918428) |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Vazquez, J; Tautz, L; Ryan, JJ; Vuori, K; Mustelin, T; Pellecchia, M Development of molecular probes for second-site screening and design of protein tyrosine phosphatase inhibitors. J Med Chem50:2137-43 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM50292295 |
|---|
| n/a |
|---|
| Name | BDBM50292295 |
|---|
| Synonyms: | 2-hydroxy-5-(5-(((1-hydroxy-2,2,6,6-tetramethylpiperidin-4-yl)amino)methyl)furan-2-yl)benzoic acid | CHEMBL390576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27N2O5 |
|---|
| Mol. Mass. | 387.4495 |
|---|
| SMILES | CC1(C)CC(CC(C)(C)N1[O])NCc1ccc(o1)-c1ccc(O)c(c1)C(O)=O |^1:10| |
|---|
| Structure | 
|
|---|
Search and Browse
