Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C9
LigandBDBM50209512
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455271
IC50 66±n/a nM
Citation Cantin LDMagnuson SGunn DBarucci NBreuhaus MBullock WHBurke JClaus THDaly MDecarr LGore-Willse AHoover-Litty HKumarasinghe ESLi YLiang SXLivingston JNLowinger TMacdougall MOgutu HOOlague AOtt-Morgan RSchoenleber RWTersteegen AWickens PZhang ZZhu JZhu LSweet LJ PDE-10A inhibitors as insulin secretagogues. Bioorg Med Chem Lett 17:2869-73 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C9
Name:Cytochrome P450 2C9
Synonyms:(R)-limonene 6-monooxygenase | (S)-limonene 6-monooxygenase | CYPIIC9 | Cytochrome P450 1A2 (CYP1A2) | Cytochrome P450 2C9 (CYP2C9 ) | Cytochrome P450 2C9 (CYP2C9) | P-450MP | P450 MP-4/MP-8 | P450 PB-1 | S-mephenytoin 4-hydroxylase
Type:Enzyme
Mol. Mass.:55636.33
Organism:Homo sapiens (Human)
Description:P11712
Residue:490
Sequence:
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209512
n/a
NameBDBM50209512
Synonyms:(S)-2-[3-cyano-2-(2'-ethoxy-biphenyl-4-yl)-6-fluoro-quinolin-4-ylamino]-propionic acid | CHEMBL397600
TypeSmall organic molecule
Emp. Form.C27H22FN3O3
Mol. Mass.455.4803
SMILESCCOc1ccccc1-c1ccc(cc1)-c1nc2ccc(F)cc2c(N[C@@H](C)C(O)=O)c1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: