| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM50228098 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_452413 (CHEMBL902649) |
|---|
| Kd | >5000000±n/a nM |
|---|
| Citation |  Stebbins, JL; Zhang, Z; Chen, J; Wu, B; Emdadi, A; Williams, ME; Cashman, J; Pellecchia, M Nuclear magnetic resonance fragment-based identification of novel FKBP12 inhibitors. J Med Chem50:6607-17 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM50228098 |
|---|
| n/a |
|---|
| Name | BDBM50228098 |
|---|
| Synonyms: | 2-(2-chlorophenoxy)-1-(2,6-dimethylmorpholino)ethanone | CHEMBL395400 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18ClNO3 |
|---|
| Mol. Mass. | 283.751 |
|---|
| SMILES | CC1CN(CC(C)O1)C(=O)COc1ccccc1Cl |w:1.0,5.5| |
|---|
| Structure | 
|
|---|
Search and Browse
