| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2 |
|---|
| Ligand | BDBM50250399 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_508373 (CHEMBL1005699) |
|---|
| IC50 | 7500±n/a nM |
|---|
| Citation |  Giannini, C; Debitus, C; Lucas, R; Ubeda, A; Payá, M; Hooper, JN; D'Auria, MV New sesquiterpene derivatives from the sponge Dysidea species with a selective inhibitor profile against human phospholipase A2 and other leukocyte functions. J Nat Prod64:612-5 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2 |
|---|
| Name: | Phospholipase A2 |
|---|
| Synonyms: | Allergen Api m I | Allergen=Api m 1 | PA2_APIME | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 (Bee) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19061.47 |
|---|
| Organism: | Apis mellifera |
|---|
| Description: | ChEMBL_1277435 |
|---|
| Residue: | 167 |
|---|
| Sequence: | MQVVLGSLFLLLLSTSHGWQIRDRIGDNELEERIIYPGTLWCGHGNKSSGPNELGRFKHT
DACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMY
FNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY
|
|
|
|---|
| BDBM50250399 |
|---|
| n/a |
|---|
| Name | BDBM50250399 |
|---|
| Synonyms: | 5-Hydroxy-4-{(R)-6-hydroxy-5-[(E)-4-methyl-6-(2,6,6-trimethyl-cyclohex-1-enyl)-hex-3-enyl]-3,6-dihydro-2H-pyran-2-yl}-5H-furan-2-one | 5-Hydroxy-4-{6-hydroxy-5-[(E)-4-methyl-6-(2,6,6-trimethyl-cyclohex-1-enyl)-hex-3-enyl]-3,6-dihydro-2H-pyran-2-yl}-5H-furan-2-one | CHEMBL463914 | manoalide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H36O5 |
|---|
| Mol. Mass. | 416.5503 |
|---|
| SMILES | C\C(CCC1=C(C)CCCC1(C)C)=C/CCC1=CC[C@@H](O[C@H]1O)C1=CC(=O)O[C@H]1O |r,c:4,t:17,25| |
|---|
| Structure | 
|
|---|
Search and Browse
