Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50248926 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_541388 (CHEMBL1023943) |
---|
Ki | 0.1±n/a nM |
---|
Citation | Zampieri, D; Grazia Mamolo, M; Laurini, E; Zanette, C; Florio, C; Collina, S; Rossi, D; Azzolina, O; Vio, L Substituted benzo[d]oxazol-2(3H)-one derivatives with preference for the sigma1 binding site. Eur J Med Chem44:124-30 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50248926 |
---|
n/a |
---|
Name | BDBM50248926 |
Synonyms: | 3-((1-(4-chlorobenzyl)piperidin-4-yl)methyl)benzo[d]oxazol-2(3H)-one | 3-[[1-(4-Chlorobenzyl)piperidin-4-yl]methyl]benzo[d]oxazol-2(3H)-one | CHEMBL473783 |
Type | Small organic molecule |
Emp. Form. | C20H21ClN2O2 |
Mol. Mass. | 356.846 |
SMILES | Clc1ccc(CN2CCC(Cn3c4ccccc4oc3=O)CC2)cc1 |
Structure |
|