Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50261082 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_552367 (CHEMBL1005957) |
---|
Ki | 7±n/a nM |
---|
Citation | Smith, TA; Yang, X; Wu, H; Pouw, B; Matsumoto, RR; Coop, A Trifluoromethoxyl substituted phenylethylene diamines as high affinity sigma receptor ligands with potent anti-cocaine actions. J Med Chem51:3322-5 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50261082 |
---|
n/a |
---|
Name | BDBM50261082 |
Synonyms: | CHEMBL498566 | N-Ethyl-2-pyrrolidin-1-yl-N-{2-[4-(trifluoromethoxy)phenyl]-ethyl}ethanamine |
Type | Small organic molecule |
Emp. Form. | C17H25F3N2O |
Mol. Mass. | 330.3884 |
SMILES | CCN(CCN1CCCC1)CCc1ccc(OC(F)(F)F)cc1 |
Structure |
|