| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM10847 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_556454 (CHEMBL955671) |
|---|
| Ki | 86000±n/a nM |
|---|
| Citation |  Colotta, V; Catarzi, D; Varano, F; Lenzi, O; Filacchioni, G; Martini, C; Trincavelli, L; Ciampi, O; Traini, C; Pugliese, AM; Pedata, F; Morizzo, E; Moro, S Synthesis, ligand-receptor modeling studies and pharmacological evaluation of novel 4-modified-2-aryl-1,2,4-triazolo[4,3-a]quinoxalin-1-one derivatives as potent and selective human A3 adenosine receptor antagonists. Bioorg Med Chem16:6086-102 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM10847 |
|---|
| n/a |
|---|
| Name | BDBM10847 |
|---|
| Synonyms: | 1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3-dimethyl-7H-purine-2,6-dione | Afonilum | Aminophyllin | Aminophylline | CHEMBL190 | Cardophyllin | Euphylline | Theophy-lline | Theophylline | Theophylline (1,3-dimethylxanthine) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H8N4O2 |
|---|
| Mol. Mass. | 180.164 |
|---|
| SMILES | Cn1c2nc[nH]c2c(=O)n(C)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
