| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl2-associated agonist of cell death |
|---|
| Ligand | BDBM50262596 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_489247 (CHEMBL989994) |
|---|
| Kd | 1000000±n/a nM |
|---|
| Citation |  Prakesch, M; Denisov, AY; Naim, M; Gehring, K; Arya, P The discovery of small molecule chemical probes of Bcl-X(L) and Mcl-1. Bioorg Med Chem16:7443-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl2-associated agonist of cell death |
|---|
| Name: | Bcl2-associated agonist of cell death |
|---|
| Synonyms: | BAD_MOUSE | Bad | Bbc6 | GST fusion protein of Bcl2 antagonist of cell death | GST-BAD |
|---|
| Type: | Other Protein Type |
|---|
| Mol. Mass.: | 22084.58 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 204 |
|---|
| Sequence: | MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
AGWTRIIQSWWDRNLGKGGSTPSQ
|
|
|
|---|
| BDBM50262596 |
|---|
| n/a |
|---|
| Name | BDBM50262596 |
|---|
| Synonyms: | 2-((2S,3R,4S)-4-(2-naphthamido)-1-(2-naphthoyl)-3-hydroxy-6-((2-methoxyethoxy)methoxy)-1,2,3,4-tetrahydroquinolin-2-yl)acetic acid | CHEMBL446860 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H34N2O8 |
|---|
| Mol. Mass. | 634.6745 |
|---|
| SMILES | COCCOCOc1ccc2N([C@@H](CC(O)=O)[C@H](O)[C@@H](NC(=O)c3ccc4ccccc4c3)c2c1)C(=O)c1ccc2ccccc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
