Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50240437 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_510226 (CHEMBL1005604) |
---|
Ki | 12±n/a nM |
---|
Citation | Fulton, BS; Knapp, BI; Bidlack, JM; Neumeyer, JL Synthesis and pharmacological evaluation of hydrophobic esters and ethers of butorphanol at opioid receptors. Bioorg Med Chem Lett18:4474-6 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50240437 |
---|
n/a |
---|
Name | BDBM50240437 |
Synonyms: | (-)-17-(cyclobutylmethyl)morphinan-3,14-diol | (-)-N-cyclobutylmethyl-3,14-dihydroxymorphinan | (-)-butorphanol | 17-(cyclobutylmethyl)morphinan-3,14-diol | BUTORPHANOL | CHEMBL33986 | US10231963, Table B.3 | US10736890, Compound TABLE B.3 | US11534436, Compound Table B.3 | US9656961, Example 00120 |
Type | Small organic molecule |
Emp. Form. | C21H29NO2 |
Mol. Mass. | 327.4605 |
SMILES | Oc1ccc2C[C@H]3N(CC4CCC4)CC[C@@]4(CCCC[C@@]34O)c2c1 |r,TLB:8:7:4.22.5:20| |
Structure |
|