Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntegrin alpha-L/beta-2 (LFA-1)
LigandBDBM50265285
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497066
IC50 4±n/a nM
Citation Lin EYGuckian KMSilvian LChin DBoriack-Sjodin PAvan Vlijmen HFriedman JEScott DM Structure-activity relationship of ortho- and meta-phenol based LFA-1 ICAM inhibitors. Bioorg Med Chem Lett 18:5245-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Integrin alpha-L/beta-2 (LFA-1)
Name:Integrin alpha-L/beta-2 (LFA-1)
Synonyms:CD11 antigen-like family member A | CD_antigen=CD11a | LFA-1A | Leukocyte adhesion glycoprotein LFA-1 alpha | Leukocyte adhesion glycoprotein LFA-1 alpha chain | Leukocyte function-associated molecule 1 alpha chain
Type:PROTEIN
Mol. Mass.:128748.90
Organism:Homo sapiens (Human)
Description:ChEMBL_629045
Residue:1170
Sequence:
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50265285
n/a
NameBDBM50265285
Synonyms:(cis)-4-(2-(4-((E)-3-morpholino-3-oxoprop-1-enyl)-2,3-bis(trifluoromethyl)phenylthio)phenoxy)cyclohexanecarboxylic acid | CHEMBL502512
TypeSmall organic molecule
Emp. Form.C28H27F6NO5S
Mol. Mass.603.573
SMILESOC(=O)[C@@H]1CC[C@@H](CC1)Oc1ccccc1Sc1ccc(\C=C\C(=O)N2CCOCC2)c(c1C(F)(F)F)C(F)(F)F |r,wU:6.9,3.2,(-5.15,-20.16,;-5.15,-21.7,;-6.48,-22.47,;-3.81,-22.48,;-3.81,-24.02,;-2.47,-24.79,;-1.13,-24.02,;-1.14,-22.47,;-2.47,-21.71,;.2,-24.79,;.21,-26.33,;-1.12,-27.1,;-1.12,-28.64,;.21,-29.41,;1.55,-28.64,;1.54,-27.09,;2.87,-26.32,;4.21,-27.08,;4.21,-28.62,;5.54,-29.38,;6.88,-28.61,;8.21,-29.37,;9.54,-28.59,;10.88,-29.36,;12.21,-28.58,;10.89,-30.9,;9.55,-31.66,;9.56,-33.19,;10.89,-33.97,;12.23,-33.19,;12.22,-31.65,;6.87,-27.06,;5.53,-26.3,;5.52,-24.76,;5.51,-23.22,;3.98,-24.77,;7.06,-24.75,;8.19,-26.28,;9.52,-25.5,;8.97,-27.61,;8.18,-24.73,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: