Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM50252865
Substrate/Competitorn/a
Meas. Tech.ChEMBL_534715
Ki 3.6±n/a nM
Citation Mason JMMurkin ASLi LSchramm VLGainsford GJSkelton BW A beta-fluoroamine inhibitor of purine nucleoside phosphorylase. J Med Chem 51:5880-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine Nucleoside Phosphorylase (PNP)
Synonyms:pfPNP
Type:Enzyme
Mol. Mass.:26857.85
Organism:Plasmodium falciparum
Description:n/a
Residue:245
Sequence:
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252865
n/a
NameBDBM50252865
Synonyms:(+/-)-cis-1-((9-Deazahypoxanthin-9-yl)methyl)-4-fluoro-4-hydroxymethylpyrrolidin-3-ol | (3S,4S)-1-((9-Deazahypoxanthin-9-yl)methyl)-4-fluoro-4-hydroxymethyl pyrrolidin-3-ol | CHEMBL498940 | Immucillins, 1
TypeSmall organic molecule
Emp. Form.C12H15FN4O3
Mol. Mass.282.2709
SMILESOC[C@@]1(F)CN(Cc2c[nH]c3c2nc[nH]c3=O)C[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: