| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM50276039 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_496860 (CHEMBL998529) |
|---|
| Ki | 103000±n/a nM |
|---|
| Citation |  Ghosh, KS; Debnath, J; Pathak, T; Dasgupta, S Using proton nuclear magnetic resonance to study the mode of ribonuclease A inhibition by competitive and noncompetitive inhibitors. Bioorg Med Chem Lett18:5503-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | RIB1 | RNAS1_HUMAN | RNASE1 | RNAse A | RNS1 | Ribonuclease A | Ribonuclease pancreatic |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17653.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 156 |
|---|
| Sequence: | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
|
|
|
|---|
| BDBM50276039 |
|---|
| n/a |
|---|
| Name | BDBM50276039 |
|---|
| Synonyms: | 1-[3-(4-CARBOXYPIPERIDIN-1-YL)-3-DEOXY-BETA-D-ARABINOFURANOSYL]PYRIMIDINE-2,4(1H,3H)-DIONE | 3'-[1-(4-carboxylpiperdinyl)]-3'-deoxy-ara-uridine | CHEMBL469949 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21N3O7 |
|---|
| Mol. Mass. | 355.3431 |
|---|
| SMILES | OC[C@H]1O[C@H]([C@@H](O)[C@@H]1N1CCC(CC1)C(O)=O)n1ccc(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
