| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26997 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_559429 (CHEMBL1018110) |
|---|
| Ki | 40000±n/a nM |
|---|
| Citation |  Isik, S; Kockar, F; Arslan, O; Guler, OO; Innocenti, A; Supuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the yeast Saccharomyces cerevisiae with anions. Bioorg Med Chem Lett18:6327-31 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAN_YEAST | NCE103 | NCE3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24861.97 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | ChEMBL_1507033 |
|---|
| Residue: | 221 |
|---|
| Sequence: | MSATESSSIFTLSHNSNLQDILAANAKWASQMNNIQPTLFPDHNAKGQSPHTLFIGCSDS
RYNENCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVIICGHTDCGGIKT
CLTNQREALPKVNCSHLYKYLDDIDTMYHEESQNLIHLKTQREKSHYLSHCNVKRQFNRI
IENPTVQTAVQNGELQVYGLLYNVEDGLLQTVSTYTKVTPK
|
|
|
|---|
| BDBM26997 |
|---|
| n/a |
|---|
| Name | BDBM26997 |
|---|
| Synonyms: | CHEMBL364571 | PhAsO3H2 | benzenarsonic acid | benzenearsonic acid | phenylarsonic acid |
|---|
| Type | n/a |
|---|
| Emp. Form. | C6H7AsO3 |
|---|
| Mol. Mass. | 202.0396 |
|---|
| SMILES | O[As](O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
