Reaction Details |
| Report a problem with these data |
Target | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
---|
Ligand | BDBM50240959 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_560474 (CHEMBL1020494) |
---|
Ki | 13000±n/a nM |
---|
Citation | Kotthaus, J; Schade, D; Muschick, N; Beitz, E; Clement, B Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. Bioorg Med Chem16:10205-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
---|
Name: | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
Synonyms: | DDAH | DDAH1 | DDAH1_HUMAN | Dimethylarginine dimethylaminohydrolase (DDAH-1) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) E78A | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L271G | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L30A | Dimethylarginine dimethylaminohydrolase 1 (DDAH1) | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
Type: | Protein |
Mol. Mass.: | 31116.90 |
Organism: | Homo sapiens (Human) |
Description: | O94760 |
Residue: | 285 |
Sequence: | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
|
|
|
BDBM50240959 |
---|
n/a |
---|
Name | BDBM50240959 |
Synonyms: | (S)-2-Amino-5-[N'-(2-methoxy-ethyl)-guanidino]-pentanoic acid | CHEMBL366222 | N-omega-(2-methoxyethyl)-L-arginine | N~5~-{IMINO[(2-METHOXYETHYL)AMINO]METHYL}-L-ORNITHINE |
Type | Small organic molecule |
Emp. Form. | C9H20N4O3 |
Mol. Mass. | 232.2801 |
SMILES | COCCNC(N)=NCCC[C@H](N)C(O)=O |r,w:7.7| |
Structure |
|