| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50254475 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558515 (CHEMBL963081) |
|---|
| IC50 | 6.1±n/a nM |
|---|
| Citation |  Zhou, N; Zeller, W; Krohn, M; Anderson, H; Zhang, J; Onua, E; Kiselyov, AS; Ramirez, J; Halldorsdottir, G; Andrésson, T; Gurney, ME; Singh, J 3,4-Disubstituted indole acylsulfonamides: a novel series of potent and selective human EP3 receptor antagonists. Bioorg Med Chem Lett19:123-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50254475 |
|---|
| n/a |
|---|
| Name | BDBM50254475 |
|---|
| Synonyms: | CHEMBL466595 | N-(4,5-dichlorothiophen-2-ylsulfonyl)-2-(3-(2,5-dimethoxyphenylsulfonyl)-1H-indol-4-yloxy)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18Cl2N2O8S3 |
|---|
| Mol. Mass. | 605.488 |
|---|
| SMILES | COc1ccc(OC)c(c1)S(=O)(=O)c1c[nH]c2cccc(OCC(=O)NS(=O)(=O)c3cc(Cl)c(Cl)s3)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
