| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcription factor Jun |
|---|
| Ligand | BDBM50279429 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_545230 (CHEMBL1019824) |
|---|
| IC50 | 3300±n/a nM |
|---|
| Citation |  Giri, RS; Thaker, HM; Giordano, T; Williams, J; Rogers, D; Sudersanam, V; Vasu, KK Design, synthesis and characterization of novel 2-(2,4-disubstituted-thiazole-5-yl)-3-aryl-3H-quinazoline-4-one derivatives as inhibitors of NF-kappaB and AP-1 mediated transcription activation and as potential anti-inflammatory agents. Eur J Med Chem44:2184-9 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcription factor Jun |
|---|
| Name: | Transcription factor Jun |
|---|
| Synonyms: | AP1 | Activator protein 1 | JUN | JUN_HUMAN | Proto-oncogene c-JUN | Transcription factor AP-1 | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 35683.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05412 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
|
|
|
|---|
| BDBM50279429 |
|---|
| n/a |
|---|
| Name | BDBM50279429 |
|---|
| Synonyms: | 3-(4-Chloro-phenyl)-2-(4-methyl-2-methylamino-thiazol-5-yl)-3H-quinazolin-4-one | CHEMBL487336 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15ClN4OS |
|---|
| Mol. Mass. | 382.867 |
|---|
| SMILES | CNc1nc(C)c(s1)-c1nc2ccccc2c(=O)n1-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
