Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBaculoviral IAP repeat-containing protein 2
LigandBDBM50255244
Substrate/Competitorn/a
Meas. Tech.ChEMBL_516265
Ki 1.27±n/a nM
Citation Sun WNikolovska-Coleska ZQin DSun HYang CYBai LQiu SWang YMa DWang S Design, synthesis, and evaluation of potent, nonpeptidic mimetics of second mitochondria-derived activator of caspases. J Med Chem 52:593-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Baculoviral IAP repeat-containing protein 2
Name:Baculoviral IAP repeat-containing protein 2
Synonyms:Baculoviral IAP repeat-containing protein 2 (cIAP1) | Cellular inhibitor of apoptosis 1 | Inhibitor of apoptosis protein 2 (cIAP1)
Type:Protein
Mol. Mass.:69900.47
Organism:Homo sapiens (Human)
Description:Q13490
Residue:618
Sequence:
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50255244
n/a
NameBDBM50255244
Synonyms:(1S,3S,6S,10aS,Z)-1-benzyl-6-((S)-2-(methylamino)propanamido)-5-oxo-N-((R)-1,2,3,4-tetrahydronaphthalen-1-yl)-1,2,3,5,6,7,10,10a-octahydropyrrolo[1,2-a]azocine-3-carboxamide | CHEMBL472832
TypeSmall organic molecule
Emp. Form.C32H40N4O3
Mol. Mass.528.685
SMILESCN[C@@H](C)C(=O)N[C@H]1C\C=C/C[C@H]2[C@@H](Cc3ccccc3)C[C@H](N2C1=O)C(=O)N[C@@H]1CCCc2ccccc12 |r,c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: