Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50248603
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562316
Ki 1.66±n/a nM
Citation Bhattacharjee HGurley SNMoore BM Design and synthesis of novel tri-aryl CB2 selective cannabinoid ligands. Bioorg Med Chem Lett 19:1691-3 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248603
n/a
NameBDBM50248603
Synonyms:(3',5'-dichloro-2,6-dimethoxybiphenyl-4-yl)(phenyl)methanol | CHEMBL460544 | US9139546, 15
TypeSmall organic molecule
Emp. Form.C21H18Cl2O3
Mol. Mass.389.272
SMILESCOc1cc(cc(OC)c1-c1cc(Cl)cc(Cl)c1)C(O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: