| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50258047 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_566697 (CHEMBL961689) |
|---|
| Ki | 1580±n/a nM |
|---|
| Citation |  Holl, R; Schepmann, D; Fröhlich, R; Grünert, R; Bednarski, PJ; Wünsch, B Dancing of the second aromatic residue around the 6,8-diazabicyclo[3.2.2]nonane framework: influence on sigma receptor affinity and cytotoxicity. J Med Chem52:2126-37 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50258047 |
|---|
| n/a |
|---|
| Name | BDBM50258047 |
|---|
| Synonyms: | (+)-(1R,2S,5S)-6-Allyl-8-(2,4-dimethoxybenzyl)-2-phenoxy-6,8-diazabicyclo[3.2.2]nonane | CHEMBL521812 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H32N2O3 |
|---|
| Mol. Mass. | 408.5332 |
|---|
| SMILES | COc1ccc(CN2C[C@@H]3CC[C@H](Oc4ccccc4)[C@H]2CN3CC=C)c(OC)c1 |r,TLB:6:7:22.21:10.11.12,13:12:22.21:8.7,THB:23:22:8.7:10.11.12| |
|---|
| Structure | 
|
|---|
Search and Browse
