new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50036749
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99492
Ki 78±n/a nM
Citation Sofia MJJackson WTSaussyJr. DLSilbaugh SAFroelich LLCockerham SLStengel PW Ortho-alkoxyphenol leukotriene B4 receptor antagonists Bioorg Med Chem Lett 2:1669-1674 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036749
n/a
NameBDBM50036749
Synonyms:1-{5-ethyl-2-hydroxy-4-[6-methyl-6-(2H-1,2,3,4-tetraazol-5-yl)heptyloxy]phenyl}-1-ethanone; with sodium ion | CHEMBL45460 | LY-255283 | Sodium salt of 1-{5-Ethyl-2-hydroxy-4-[6-methyl-6-(2H-tetrazol-5-yl)-heptyloxy]-phenyl}-ethanone | sodium 1-{5-ethyl-2-hydroxy-4-[6-methyl-6-(2H-1,2,3,4-tetraazol-5-yl)heptyloxy]phenyl}-1-ethanone
TypeSmall organic molecule
Emp. Form.C19H27N4O3
Mol. Mass.359.4432
SMILESCCc1cc(C(C)=O)c(O)cc1OCCCCCC(C)(C)c1nn[n-]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: