Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50280654 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_212347 |
---|
IC50 | 20±n/a nM |
---|
Citation | Sall, DJ; Berry, DR; Coffman, WJ; Craft, TJ; Denney, ML; Gifford-Moore, DS; Kellam, ML; Smith, GF Characterization of LY806303 as a potent and selective inhibitor of thrombin Bioorg Med Chem Lett2:1025-1028 (1992) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM50280654 |
---|
n/a |
---|
Name | BDBM50280654 |
Synonyms: | (S)-5-Guanidino-2-{[(S)-1-((S)-2-methylamino-2-phenyl-acetyl)-pyrrolidine-2-carbonyl]-amino}-pentanoic acid | CHEMBL8108 |
Type | Small organic molecule |
Emp. Form. | C20H30N6O4 |
Mol. Mass. | 418.49 |
SMILES | CN[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)c1ccccc1 |
Structure |
|