| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50281324 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159776 |
|---|
| pH | 6±n/a |
|---|
| IC50 | 10±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Fässler, A; Rösel, J; Grüther, M; Tintelnot-Blomley, M; Atteri, E; Bold, G; Lang, M Novel pseudosymmetric inhibitors of HIV-1 protease Bioorg Med Chem Lett3:2837-2842 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50281324 |
|---|
| n/a |
|---|
| Name | BDBM50281324 |
|---|
| Synonyms: | ((S)-1-{N'-[(2S,3S)-3-((S)-2-Benzyloxycarbonylamino-3-methyl-butyrylamino)-2-hydroxy-4-phenyl-butyl]-N'-isobutyl-hydrazinocarbonyl}-2-methyl-propyl)-carbamic acid benzyl ester | CHEMBL317204 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H55N5O7 |
|---|
| Mol. Mass. | 717.894 |
|---|
| SMILES | CC(C)CN(C[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)C)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
