BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C alpha type
LigandBDBM50099646
Substrate/Competitorn/a
Meas. Tech.ChEBML_221029
Ki 0.140000±n/a nM
Citation Winkler JDHong BCBahador AKazanietz MGBlumberg PM Synthesis of ingenol analogs wth affinity for protein kinase C Bioorg Med Chem Lett 3:577-580 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C alpha type
Name:PKC alpha and beta-2
Synonyms:PKC alpha | PKC-A | PKC-alpha | Protein Kinase C- alpha | Protein kinase C alpha | Protein kinase C alpha (PKCa) | Protein kinase C alpha type (PKC-A) | Protein kinase C alpha type (PRKCA) | Proto-oncogene c-RAF | RAF proto-oncogene serine/threonine-protein kinase
Type:Enzyme
Mol. Mass.:76755.65
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:672
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099646
n/a
NameBDBM50099646
Synonyms:5,6-dihydroxy-7-hydroxymethyl-3,11,11,14-tetramethyl-15-oxo-4-phenylcarbonyloxy-(14R)-tetracyclo[7.5.1.01,5.010,12]pentadeca-2,7-diene | CHEMBL46094 | Ingenol-3-bezoate
TypeSmall organic molecule
Emp. Form.C27H32O6
Mol. Mass.452.5394
SMILESC[C@@H]1C[C@@H]2[C@H]([C@@H]3C=C(CO)[C@@H](O)[C@]4(O)[C@@H](OC(=O)c5ccccc5)C(C)=CC14C3=O)C2(C)C |c:26,t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: