| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50282077 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159640 (CHEMBL763584) |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Babine, RE; Zhang, N; Schow, SR; Jirousek, MR; Johnson, BD; Kerwar, SS; Desai, PR; Byrn, RA; Hastings, RC; Wick, MM Structure activity studies on pseudo-symmetrical HIV-1 protease inhibitors Bioorg Med Chem Lett3:1589-1594 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50282077 |
|---|
| n/a |
|---|
| Name | BDBM50282077 |
|---|
| Synonyms: | (S)-2-((S)-2-{(2R,6R)-2-Butyl-4-hydroxy-6-[(S)-1-((S)-1-methoxycarbonyl-2-methyl-propylcarbamoyl)-2-methyl-propylcarbamoyl]-decanoylamino}-3-methyl-butyrylamino)-3-methyl-butyric acid methyl ester | CHEMBL39130 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H68N4O9 |
|---|
| Mol. Mass. | 712.9572 |
|---|
| SMILES | CCCC[C@H](CC(O)C[C@@H](CCCC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)OC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
