Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50403197 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159319 (CHEMBL769372) |
---|
IC50 | 30±n/a nM |
---|
Citation | Trova, MP; Babine, RE; Byrn, RA; Casscles, WT; Hastings, RC; Hsu, GC; Jirousek, MR; Johnson, BD; Kerwar, SS; Schow, SR; Wissner, A; Zhang, N; Wick, MM Synthesis and biological evaluation of a series of HIV-1 protease inhibitors Bioorg Med Chem Lett3:1595-1600 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50403197 |
---|
n/a |
---|
Name | BDBM50403197 |
Synonyms: | CHEMBL2115378 |
Type | Small organic molecule |
Emp. Form. | C40H58N6O4 |
Mol. Mass. | 686.9263 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](C[C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)Cc1ccccc1)C(=O)NCc1nc2ccccc2[nH]1 |
Structure |
|