| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50282102 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159319 (CHEMBL769372) |
|---|
| IC50 | 250±n/a nM |
|---|
| Citation |  Trova, MP; Babine, RE; Byrn, RA; Casscles, WT; Hastings, RC; Hsu, GC; Jirousek, MR; Johnson, BD; Kerwar, SS; Schow, SR; Wissner, A; Zhang, N; Wick, MM Synthesis and biological evaluation of a series of HIV-1 protease inhibitors Bioorg Med Chem Lett3:1595-1600 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50282102 |
|---|
| n/a |
|---|
| Name | BDBM50282102 |
|---|
| Synonyms: | 1-((R)-2-Hydroxy-4-{(1S,2S)-2-methyl-1-[(pyridin-2-ylmethyl)-carbamoyl]-butylcarbamoyl}-5-phenyl-pentyl)-piperidine-2-carboxylic acid tert-butylamide | CHEMBL42366 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H51N5O4 |
|---|
| Mol. Mass. | 593.7998 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](CC(O)CN1CCCCC1C(=O)NC(C)(C)C)Cc1ccccc1)C(=O)NCc1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
