| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50282495 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_79818 (CHEMBL695237) |
|---|
| IC50 | 1.000±n/a nM |
|---|
| Citation |  Peyman, A; Wagner, K; Budt, KH; Spanig, J; Ruppert, D; Meichsner, C; Paessens, A Inhibition of human immunodeficiency virus-1 protease by a C2-symmetrical phosphinic acid amide Bioorg Med Chem Lett4:1191-1194 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50282495 |
|---|
| n/a |
|---|
| Name | BDBM50282495 |
|---|
| Synonyms: | Bis-((R)-1-{(S)-3-methyl-2-[(S)-3-(2-methyl-propane-2-sulfonyl)-2-naphthalen-1-ylmethyl-propionylamino]-butyrylamino}-2-phenyl-ethyl)-phosphinic amide | Bis-((S)-1-{(S)-3-methyl-2-[(S)-3-(2-methyl-propane-2-sulfonyl)-2-naphthalen-1-ylmethyl-propionylamino]-butyrylamino}-2-phenyl-ethyl)-phosphinic amide | CHEMBL413390 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C62H80N5O9PS2 |
|---|
| Mol. Mass. | 1134.43 |
|---|
| SMILES | CC(C)[C@H](NC(=O)[C@H](Cc1cccc2ccccc12)CS(=O)(=O)C(C)(C)C)C(=O)N[C@H](Cc1ccccc1)P(N)(=O)[C@@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](Cc1cccc2ccccc12)CS(=O)(=O)C(C)(C)C)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
