| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50283517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_136092 (CHEMBL884714) |
|---|
| IC50 | 200±n/a nM |
|---|
| Citation |  Hedberg, MH; Johansson, AM; Fowler, CJ; Terenius, L; Hacksell, U Palladium-catalyzed synthesis of C3-substituted 3-deoxymorphines. Bioorg Med Chem Lett4:2527-2532 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50283517 |
|---|
| n/a |
|---|
| Name | BDBM50283517 |
|---|
| Synonyms: | 10-(3-furyl)-4-methyl-(1S,5R,13R,14S,17R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7(18),8,10,15-tetraen-14-ol | CHEMBL87247 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21NO3 |
|---|
| Mol. Mass. | 335.3963 |
|---|
| SMILES | CN1CC[C@@]23[C@H]4Oc5c2c(C[C@@H]1[C@@H]3C=C[C@@H]4O)ccc5-c1ccoc1 |c:16| |
|---|
| Structure | 
|
|---|
Search and Browse
