| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50283567 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159624 (CHEMBL760103) |
|---|
| IC50 | 240±n/a nM |
|---|
| Citation |  Peyman, A; Stahl, W; Wagner, K; Ruppert, D; Budt, KH Non-peptide-based inhibitors of human immunodeficiency virus-1 protease Bioorg Med Chem Lett4:2601-2604 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50283567 |
|---|
| n/a |
|---|
| Name | BDBM50283567 |
|---|
| Synonyms: | 4,6-Dibenzyl-5-hydroxy-1,3-bis-(4-hydroxymethyl-benzyl)-5-oxo-5lambda*5*-[1,3,5]diazaphosphinan-2-one | CHEMBL432178 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H35N2O5P |
|---|
| Mol. Mass. | 570.6152 |
|---|
| SMILES | OCc1ccc(CN2C(Cc3ccccc3)P(O)(O)=C(Cc3ccccc3)N(Cc3ccc(CO)cc3)C2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
