| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50283820 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79969 |
|---|
| Ki | 13±n/a nM |
|---|
| Citation |  Ettmayer, P; Hübner, M; Andreas, B; Brigitte, R; Hubert, G Novel, extended transition state mimic in HIV-1 protease inhibitors with peripheral C-2-symmetry Bioorg Med Chem Lett4:2851-2856 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50283820 |
|---|
| n/a |
|---|
| Name | BDBM50283820 |
|---|
| Synonyms: | ((S)-1-{(1S,2S,3S,4S)-4-[(S)-2-(1H-Benzoimidazol-2-ylmethoxycarbonylamino)-3,3-dimethyl-butyrylamino]-1-benzyl-3-hydroxy-2-hydroxymethyl-5-phenyl-pentylcarbamoyl}-2,2-dimethyl-propyl)-carbamic acid 1H-benzoimidazol-2-ylmethyl ester | CHEMBL98288 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H60N8O8 |
|---|
| Mol. Mass. | 889.0495 |
|---|
| SMILES | CC(C)(C)[C@H](NC(=O)OCc1nc2ccccc2[nH]1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](CO)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1nc2ccccc2[nH]1)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
