Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50284031 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79809 (CHEMBL696069) |
---|
IC50 | 350±n/a nM |
---|
Citation | Babine, RE; Zhang, N; Schow, SR; Xu, Z; Byrn, RA; Hastings, RC; Semmelhack, MF; Wick, MM; Kerwar, SS Design, structure activity and x-ray crystallographic studies of pseudosymmetrical nonpeptidyl HIV-1 protease inhibitors Bioorg Med Chem Lett4:583-588 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50284031 |
---|
n/a |
---|
Name | BDBM50284031 |
Synonyms: | (2R,6R)-2,6-Dibenzyl-4-hydroxy-heptanedioic acid bis-({(1S,2S)-2-[(pyridine-4-carbonyl)-amino]-cyclohexyl}-amide) | CHEMBL156839 |
Type | Small organic molecule |
Emp. Form. | C45H54N6O5 |
Mol. Mass. | 758.9475 |
SMILES | OC(C[C@@H](Cc1ccccc1)C(=O)N[C@H]1CCCC[C@@H]1NC(=O)c1ccncc1)C[C@@H](Cc1ccccc1)C(=O)N[C@H]1CCCC[C@@H]1NC(=O)c1ccncc1 |
Structure |
|