| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50014144 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_79954 (CHEMBL687725) |
|---|
| IC50 | <1±n/a nM |
|---|
| Citation |  Mazaleyrat, JP; Rage, I; Šavrda, J; Mouna, M; Wakselman, M; Boulay, R; Lelièvre, Y Synthesis of C2-symmetric inhibitors of the HIV-1 protease, with N,N′-substituted ethylenediamide and ethylenediamine linkers. Bioorg Med Chem Lett4:653-656 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50014144 |
|---|
| n/a |
|---|
| Name | BDBM50014144 |
|---|
| Synonyms: | CHEMBL83462 | {(S)-1-[(1S,2R,3R,4S)-1-Benzyl-4-((R)-2-benzyloxycarbonylamino-3-methyl-butyrylamino)-2,3-dihydroxy-5-phenyl-pentylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester | {1-[1-Benzyl-4-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-2,3-dihydroxy-5-phenyl-pentylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H54N4O8 |
|---|
| Mol. Mass. | 766.9216 |
|---|
| SMILES | CC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](NC(=O)OCc1ccccc1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
