| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50284215 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49462 (CHEMBL657106) |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Player, MR; Sr., JS; Patil, GS; Chih-Min, K; Powers, JC 1,3-Oxazino[4,5-b]indole-2,4-(1H,9H)-diones and 5,6-dimethylpyrrolo-[2,3-d]-1,3-oxazin-2,4-(1H,7H)-diones as serine protease inhi... Bioorg Med Chem Lett4:949-954 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50284215 |
|---|
| n/a |
|---|
| Name | BDBM50284215 |
|---|
| Synonyms: | Acetic acid 9-(2,2-dimethoxy-ethyl)-2,4-dioxo-1,2,4,9-tetrahydro-[1,3]oxazino[4,5-b]indol-6-yl ester | CHEMBL173369 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16N2O7 |
|---|
| Mol. Mass. | 348.3074 |
|---|
| SMILES | COC(Cn1c2ccc(OC(C)=O)cc2c2c(O)oc(=O)nc12)OC |
|---|
| Structure | 
|
|---|
Search and Browse
