new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50286027
Substrate/Competitorn/a
Meas. Tech.ChEBML_155151
Ki 0.370000±n/a nM
Citation Sheppard GSDavidsen SKCarrera GMPireh DHolms JHHeyman HRSteinman DHCurtin MLConway RGRhein DAAlbert DHTapang PMagoc TJSummers JB Synthesis and evaluation of water soluble indole pyrrolothiazole paf antagonists Bioorg Med Chem Lett 5:2913-2918 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286027
n/a
NameBDBM50286027
Synonyms:6-(4-Fluoro-phenyl)-3-[[(Z)-hydroxyimino]-((R)-3-pyridin-3-yl-1H-pyrrolo[1,2-c]thiazol-7-yl)-methyl]-indole-1-carboxylic acid dimethylamide | CHEMBL95440
TypeSmall organic molecule
Emp. Form.C29H24FN5O2S
Mol. Mass.525.597
SMILESCN(C)C(=O)n1cc(C(N=O)c2ccn3[C@H](SCc23)c2cccnc2)c2ccc(cc12)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: