| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50286103 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_136091 |
|---|
| IC50 | 0.330000±n/a nM |
|---|
| Citation |  Husbands, SM; Lewis, JW Morphinan cyclic imines and pyrrolidines containing a constrained phenyl group: High affinity opioid agonists Bioorg Med Chem Lett5:2969-2974 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50286103 |
|---|
| n/a |
|---|
| Name | BDBM50286103 |
|---|
| Synonyms: | CHEMBL102092 | Morphinan Cyclic Imine analogue |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H30N2O2 |
|---|
| Mol. Mass. | 426.55 |
|---|
| SMILES | COC12C=CC34C[C@@]1(C)C(=N[C@H]2C31CCN(C)C4Cc2ccc(O)cc12)c1ccccc1 |c:3,10,TLB:24:25:5:15.13.14,26:9:2:12.5.6,16:15:5:25.19.18,THB:4:5:25.19.18:15.13.14| |
|---|
| Structure | 
|
|---|
Search and Browse
