new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50286305
Substrate/Competitorn/a
Meas. Tech.ChEBML_219643
Ki 0.800000±n/a nM
Citation Subramanyam CBell MRFerguson EGordon RGDunlap RPFranke CMura AJ Inhibitors of human leukocyte elastase. 2.1 synthesis and sar of benzisothiazolinylmethyl aryl ethers Bioorg Med Chem Lett 5:319-324 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286305
n/a
NameBDBM50286305
Synonyms:2-[2-Chloro-4-(morpholine-4-sulfonyl)-phenoxymethyl]-4-isopropyl-1,1-dioxo-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL109234
TypeSmall organic molecule
Emp. Form.C21H23ClN2O7S2
Mol. Mass.515
SMILESCC(C)c1cccc2c1C(=O)N(COc1ccc(cc1Cl)S(=O)(=O)N1CCOCC1)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: