| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50286323 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_86691 (CHEMBL694282) |
|---|
| Ki | 1±n/a nM |
|---|
| Citation |  Subramanyam, C; Bell, MR; Ghose, AK; Kumar, V; Dunlap, RP; Franke, C; Mura, AJ Inhibitors of human leukocyte elastase. 3.1 inhibition by tetrahydrobenzisothiazolinylmethyl aryl carboxylates Bioorg Med Chem Lett5:325-330 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50286323 |
|---|
| n/a |
|---|
| Name | BDBM50286323 |
|---|
| Synonyms: | 2,6-Dichloro-benzoic acid 4-methyl-1,1,3-trioxo-1,3,4,5,6,7-hexahydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester | CHEMBL326136 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15Cl2NO5S |
|---|
| Mol. Mass. | 404.265 |
|---|
| SMILES | CC1CCCC2=C1C(=O)N(COC(=O)c1c(Cl)cccc1Cl)S2(=O)=O |c:5| |
|---|
| Structure | 
|
|---|
Search and Browse
