| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50286678 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_86700 |
|---|
| KON | 80 M-1s-1 |
|---|
| Citation |  Alpegiani, M; Bissolino, P; Corigli, R; Rizzo, V; Perrone, E Tricyclic cephems as inhibitors of human leukocyte elastase. thieno[3,4-c]cepham sulfones and pyrrolo[3,4-c]cepham sulfones Bioorg Med Chem Lett5:691-694 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50286678 |
|---|
| n/a |
|---|
| Name | BDBM50286678 |
|---|
| Synonyms: | (2S,2aR)-7-tert-Butyl-2-methoxy-3,3-dioxo-2,2a,3,4-tetrahydro-3lambda*6*,6-dithia-7b-aza-cyclobuta[e]inden-1-one | CHEMBL159512 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H17NO4S2 |
|---|
| Mol. Mass. | 315.408 |
|---|
| SMILES | CO[C@@H]1[C@@H]2N(C1=O)c1c(CS2(=O)=O)csc1C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
