new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50284680
Substrate/Competitorn/a
Meas. Tech.ChEBML_99655
Ki 38000±n/a nM
Citation Masamune HBreslow RCheng JBConklyn MJEggler JFMarfat AMelvin LSPillar JSShirley JTShowell HJTickner JE Synthesis and in vitro profile of 7-substituted quinoline chromanols as novel, non-acidic LTB4 antagonists Bioorg Med Chem Lett 5:887-892 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284680
n/a
NameBDBM50284680
Synonyms:(3S,4S)-3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | 3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | CHEMBL282524 | CP-80798
TypeSmall organic molecule
Emp. Form.C25H22N2O3
Mol. Mass.398.4538
SMILESO[C@H]1[C@@H](Cc2cccnc2)COc2ccc(OCc3ccc4ccccc4n3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: