new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50056101
Substrate/Competitorn/a
Meas. Tech.ChEBML_48441
IC50 0.110000±n/a nM
Citation Semple GRyder HKendrick DASzelke MOhta MSatoh MNishida AAkuzawa SMiyata K Synthesis and biological activity of 5-heteroaryl benzodiazepines: analogues of YM022 Bioorg Med Chem Lett 6:55-58 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
CCKBR
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48980.43
Organism:RAT
Description:Cholecystokinin A CCKBR RAT::P30553
Residue:452
Sequence:
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056101
n/a
NameBDBM50056101
Synonyms:1-[(R)-2-Oxo-1-(2-oxo-2-o-tolyl-ethyl)-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl]-3-m-tolyl-urea | CHEMBL115121 | YM022 | YM022 Racemate
TypeSmall organic molecule
Emp. Form.C32H28N4O3
Mol. Mass.516.5897
SMILESCc1cccc(NC(=O)N[C@@H]2N=C(c3ccccc3)c3ccccc3N(CC(=O)c3ccccc3C)C2=O)c1 |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: