| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50286985 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159467 |
|---|
| pH | 4.7±n/a |
|---|
| IC50 | 67±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Steinbaugh, BA; Hamilton, HW; Prasad, JV; Para, KS; J., TP; Ferguson, D; Lunney, EA; Blankley, CJ A topliss tree analysis of the HIV-protease inhibitory activity of 6-phenyl-4-hydroxy-pyran-2-ones Bioorg Med Chem Lett6:1099-1104 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50286985 |
|---|
| n/a |
|---|
| Name | BDBM50286985 |
|---|
| Synonyms: | 4-Hydroxy-3-(2-isopropyl-phenylsulfanyl)-6-(3-nitro-phenyl)-pyran-2-one | CHEMBL275937 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17NO5S |
|---|
| Mol. Mass. | 383.418 |
|---|
| SMILES | CC(C)c1ccccc1Sc1c(O)cc(oc1=O)-c1cccc(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
