new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50240434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196586
Ki 0.500000±n/a nM
Citation Neenan JPOpitz SMCooke CLUssery MAMorrill TCEckel LM Adenosine dialdehyde analogs I: Regioselective synthesis of adenosine monoaldehydes Bioorg Med Chem Lett 6:1381-1386 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47714.06
Organism:Homo sapiens (Human)
Description:ChEMBL_1507791
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240434
n/a
NameBDBM50240434
Synonyms:2-[1-(6-Amino-purin-9-yl)-2-oxo-ethoxy]-propenal | CHEMBL280595
TypeSmall organic molecule
Emp. Form.C10H9N5O3
Mol. Mass.247.2102
SMILESNc1ncnc2n(cnc12)C(OC(=C)C=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: