new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50403583
Substrate/Competitorn/a
Meas. Tech.ChEBML_196637
Kd>1000±n/a nM
Citation Vuligonda VLin YChandraratna RA Synthesis of highly potent RXR-specific retinoids: The use of a cyclopropyl group as a double bond isostere Bioorg Med Chem Lett 6:213-218 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoid receptor
Synonyms:Nuclear receptor subfamily 2 group B member 2 | Retinoic acid receptor RXR-beta | Retinoid X receptor beta
Type:PROTEIN
Mol. Mass.:56932.89
Organism:Homo sapiens (Human)
Description:ChEMBL_39045
Residue:533
Sequence:
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403583
n/a
NameBDBM50403583
Synonyms:CHEMBL2111535
TypeSmall organic molecule
Emp. Form.C24H32O2
Mol. Mass.352.5097
SMILESC\C(\C=C\C1CC1(C)c1ccc2c(c1)C(C)(C)CCC2(C)C)=C\C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: