| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Subtilisin BL |
|---|
| Ligand | BDBM50067906 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_98917 (CHEMBL708726) |
|---|
| Ki | 204000±n/a nM |
|---|
| Citation |  Stabile, MR; Lai, WG; DeSantis, G; Gold, M; Jones, JB; Mitchinson, C; Bott, RR; Graycar, TP; Liu, CC Probing the specificity of the S1 binding site of M222 mutants of subtilisin B. lentus with boronic acid inhibitors Bioorg Med Chem Lett6:2501-2506 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Subtilisin BL |
|---|
| Name: | Subtilisin BL |
|---|
| Synonyms: | SUBB_LEDLE | Subtilisin |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26829.89 |
|---|
| Organism: | Bacillus lentus |
|---|
| Description: | ChEMBL_197707 |
|---|
| Residue: | 269 |
|---|
| Sequence: | AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGN
GHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVA
NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNR
ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI
RNHLKNTATSLGSTNLYGSGLVNAEAATR
|
|
|
|---|
| BDBM50067906 |
|---|
| n/a |
|---|
| Name | BDBM50067906 |
|---|
| Synonyms: | (3-aminophenyl)boronic acid, 1 | 3-aminophenyl boronic acid | 3-aminophenylboronic acid | Aza-boronic acid derivative | Boronic acid derivative | CHEMBL20852 | M-AMINOPHENYLBORONIC ACID |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H8BNO2 |
|---|
| Mol. Mass. | 136.944 |
|---|
| SMILES | Nc1cccc(c1)B(O)O |
|---|
| Structure | 
|
|---|
Search and Browse
