Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50282878 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158078 |
---|
Ki | 14±n/a nM |
---|
KON | 5600 M-1s-1 |
---|
Citation | Hlasta, DJ; Court, JJ; Desai, RC; Talomie, TG; Shen, J; Dunlap, RP; and, CA; Mura, AJ A comparative SAR and computer modeling study of benzisothiazolone, mechanism-based inhibitors with porcine pancreatic and human leukocyte elastase Bioorg Med Chem Lett6:2941-2946 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50282878 |
---|
n/a |
---|
Name | BDBM50282878 |
Synonyms: | 4-Methoxy-1,1-dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL432890 |
Type | Small organic molecule |
Emp. Form. | C16H13N5O4S2 |
Mol. Mass. | 403.436 |
SMILES | COc1cccc2c1C(=O)N(CSc1nnnn1-c1ccccc1)S2(=O)=O |
Structure |
|