| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50289056 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_160737 |
|---|
| pH | 4.7±n/a |
|---|
| IC50 | 1103±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Hamilton, HW; Tait, BD; Gajda, C; Hagen, SE; Ferguson, D; Lunney, EA; Pavlovsky, A; Tummino, PJ 6-Phenyl-6-alkylamido-5,6-dihydro-2H-pyran-2-ones: novel HIV protease inhibitors Bioorg Med Chem Lett6:719-724 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50289056 |
|---|
| n/a |
|---|
| Name | BDBM50289056 |
|---|
| Synonyms: | 4-Hydroxy-3-(2-isopropyl-phenylsulfanyl)-6-(3-oxo-3-thiomorpholin-4-yl-propyl)-6-phenyl-5,6-dihydro-pyran-2-one | CHEMBL439833 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H31NO4S2 |
|---|
| Mol. Mass. | 497.669 |
|---|
| SMILES | CC(C)c1ccccc1SC1C(=O)CC(CCC(=O)N2CCSCC2)(OC1=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
