new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, PKC; classical/novel
LigandBDBM50289211
Substrate/Competitorn/a
Meas. Tech.ChEMBL_153123
IC50<25±n/a nM
Citation Hu HHollinshead SPHall SEKalter KBallas LM Synthesis and protein kinase C inhibitory activities of indane analogs of balanol Bioorg Med Chem Lett 6:973-978 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, PKC; classical/novel
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC-L | nPKC-eta
Type:Enzyme
Mol. Mass.:77844.26
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:683
Sequence:
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50289211
n/a
NameBDBM50289211
Synonyms:4-(2-Carboxy-6-hydroxy-benzoyl)-3,5-dihydroxy-benzoic acid (R)-2-(4-hydroxy-benzoylamino)-indan-1-yl ester | CHEMBL367162
TypeSmall organic molecule
Emp. Form.C31H23NO10
Mol. Mass.569.515
SMILESOC(=O)c1cccc(O)c1C(=O)c1c(O)cc(cc1O)C(=O)OC1[C@@H](Cc2ccccc12)NC(=O)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: