new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman leukocyte antigen DR beta chain
LigandBDBM50079824
Substrate/Competitorn/a
Meas. Tech.ChEMBL_192856
IC50 17±n/a nM
Citation Cunningham BRRivetna MTolman RLFlattery SJNichols EASchwartz CDWicker LSHermes JDJones AB SAR for MHC class II binding tetrapeptides: Correlation with potential binding site Bioorg Med Chem Lett 7:19-24 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Human leukocyte antigen DR beta chain
Name:Human leukocyte antigen DR beta chain
Synonyms:DR-1 | DR1 | HLA class II histocompatibility antigen, DRB1-1 beta chain | MHC class I antigen DRB1*1
Type:PROTEIN
Mol. Mass.:29917.79
Organism:Homo sapiens (Human)
Description:ChEMBL_192854
Residue:266
Sequence:
MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCI
YNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079824
n/a
NameBDBM50079824
Synonyms:((S)-1-{(S)-1-[(S)-(S)-1-(1-Carbamoyl-3-methyl-butylcarbamoyl)-butylcarbamoyl]-4-guanidino-butylcarbamoyl}-2-phenyl-ethyl)-carbamic acid ethyl ester | ((S)-1-{(S)-1-[(S)-1-((S)-1-Carbamoyl-3-methyl-butylcarbamoyl)-butylcarbamoyl]-4-guanidino-butylcarbamoyl}-2-phenyl-ethyl)-carbamic acid ethyl ester | CHEMBL292340
TypeSmall organic molecule
Emp. Form.C29H48N8O6
Mol. Mass.604.7414
SMILESCCC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)OCC)C(=O)N[C@@H](CC(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: